PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_46011.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 97aa    MW: 11223.6 Da    PI: 10.0936
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_46011.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof129.41e-403190362
                   zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             +++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn k+s
  Rsa1.0_46011.1_g00001.1 31 QEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNAKRS 90
                             7899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.0E-343288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3943488IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-263489IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MQDPAAYYQS MMAKQLHQQQ QQQQQPQFPD QEQLKCPRCD SPNTKFCYYN NYNLSQPRHF  60
CKSCRRYWTK GGALRNVPVG GGSRKNAKRS TSSSTSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406292.13e-50hypothetical protein EUTSA_v10021538mg
SwissprotO821552e-46DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLV4LBD44e-50V4LBD4_EUTSA; Uncharacterized protein
STRINGscaffold_302540.13e-48(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.14e-43DOF zinc finger protein 2